SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8W8X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A8W8X3
Domain Number - Region: 84-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0863
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8W8X3
Sequence length 169
Comment (tr|A0A0A8W8X3|A0A0A8W8X3_PAESO) Uncharacterized protein {ECO:0000313|EMBL:CEK38487.1} KW=Complete proteome; Reference proteome OX=1505 OS=Paeniclostridium sordellii (Clostridium sordellii). GN=JGS6382_18191 OC=Peptostreptococcaceae; Paeniclostridium.
Sequence
MAKIVIKSEILEMMLYIWDSLHQKEKIADSFFIELADQTDMKYLYDEDFTKESVRKVLSA
MSNRELLNKPTKKESRYWNKNMWMLEDLEFTNMMIAPVKQLNLDYMEDKLSKEEYEVIFI
PGHMDEYYIDENKLIINFFNITVDLFGEGPVTIAGKPFNEYIEEKLLSI
Download sequence
Identical sequences A0A0A8W8X3
WP_021129390.1.14710 WP_021129390.1.71451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]