SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9CN95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9CN95
Domain Number 1 Region: 173-273
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.07e-22
Family Helical domain of Sec23/24 0.0036
Further Details:      
 
Domain Number 2 Region: 61-171
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-20
Family beta-sandwich domain of Sec23/24 0.0094
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily vWA-like 0.00000189
Family Trunk domain of Sec23/24 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9CN95
Sequence length 318
Comment (tr|A0A0A9CN95|A0A0A9CN95_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAD75918.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MKWMESLGHEAQRHSTIVDILCAGTCPVRVPVLQPLAKCSGGVLLLHDDFGEAFGVNLQR
ASTRAAGSHGLFEIRCSDNMLVTQVIGPGEEASPDSHETFKHDTSFCIQMHSVEEMQSFS
VSMETKGDIKNDFVFFQFAVRYSNMYQAEVTRVITMRLQTVDGLSAYLASVQEDVASVIV
GKRTVLRARTASDAIDMRISIDERVKDIALKFGSQAPKSKLYRFPKELASLPECLFHLKR
GPLLGSIIGHEDERSVLRNLFLNASFDLSLRMLAPRCIMHREGGTFEELPAYDLAMQSSA
AVVLDHGTDIFIWLVCYL
Download sequence
Identical sequences A0A0A9CN95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]