SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9G3Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9G3Q5
Domain Number 1 Region: 19-61
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000177
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A9G3Q5
Sequence length 75
Comment (tr|A0A0A9G3Q5|A0A0A9G3Q5_ARUDO) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MFASCLAVRGPGADGMGRLVDSATGAEYVPTYEDKDGDWMLVGDVPFKMFVDSCKRIRLM
KSSEAVNLSPRTSSQ
Download sequence
Identical sequences A0A0A9G3Q5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]