SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9HJ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9HJ41
Domain Number 1 Region: 2-250
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-62
Family Hect, E3 ligase catalytic domain 0.0000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9HJ41
Sequence length 257
Comment (tr|A0A0A9HJ41|A0A0A9HJ41_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAE32918.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MLEQELDIYDIQSFDPELGKTIIEFQALVNRKKFLETSSRTSNPTADLSYKNVKLEDLCL
DFTLPGNPEYELVPGGSEKMVTLESLEEYVSLVVDATLKSGIAKQIEAFKSGISEVLALK
TLKMFTEEEMERILCGEQDSWASQNLEDYIDFEHGYDMSSPSIISFLEILHEFGREEQRA
FILFTTGAPQLPLGGLVSLDPKLTVVQKQCDGNVDDELPSVNTCRHFIKLPPYSSKEIMR
KKLKYAFTEGLGSFHLS
Download sequence
Identical sequences A0A0A9HJ41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]