SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9PWM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9PWM8
Domain Number 1 Region: 40-117
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.58e-30
Family Ribosomal L27 protein 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A9PWM8
Sequence length 146
Comment (tr|A0A0A9PWM8|A0A0A9PWM8_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAF23144.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MAFSSVFRRINVKDLTSKVSVYTSATELSGGLNVMFRRWATKKTAGSTKNGRDSNPKYLG
VKKFGGEKVQPGNIIVHQRGTHFHPGNYVGMGKDHTLFCLKEGHARFERNKLTGRKWFHV
DPLAGHVLDPMYLDGSASTAGTDPLH
Download sequence
Identical sequences A0A0A9PWM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]