SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9QYA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9QYA0
Domain Number 1 Region: 4-28
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000387
Family Plexin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9QYA0
Sequence length 42
Comment (tr|A0A0A9QYA0|A0A0A9QYA0_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAF37827.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MNSCSMYQKFEHDCLMAAPPFCNWGLHPLFYIRRIPRAIKTS
Download sequence
Identical sequences A0A0A9QYA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]