SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9SHC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9SHC8
Domain Number 1 Region: 59-197
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.44e-43
Family Poly(A) polymerase, PAP, middle domain 0.00018
Further Details:      
 
Domain Number 2 Region: 198-317
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 8.04e-22
Family Poly(A) polymerase, PAP, C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A9SHC8
Sequence length 354
Comment (tr|A0A0A9SHC8|A0A0A9SHC8_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAF56772.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MRFRFDGIAVDFTYAQLPAIDASKAINTIGPQLLQKIDGRSWNSLSGVRVNEKIVQLVPE
AEKFQVLLRCIKLWARKRGLHCHHLGFFAGIHLAILAAYVCQRYPDASGNGLFTVFFQTF
AHWPWPVPVSLHDQPTNGLYSEGHLMPIVTPCTPPEFCMSNVTKSTFNKIRQELMRGYAL
TKDPLRHDFEWAWLFEPFPYAANYQHFLRIILCAPTSAELRDWAGWIKSRFHYLILKLEK
IDVECDPWPSEEVDHTVIKPNIVYYWGLIPQRFMHIDTSTLKEDFLKDVTNDVYGKVKCT
RSDLTISVVGLTQLPKSMCSSHSAHWQYMPDPALYGGLPGYRTSGPDCSWVGRG
Download sequence
Identical sequences A0A0A9SHC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]