SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9UI04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9UI04
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000000208
Family Poly(A) polymerase, PAP, middle domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A9UI04
Sequence length 48
Comment (tr|A0A0A9UI04|A0A0A9UI04_ARUDO) Uncharacterized protein {ECO:0000313|EMBL:JAF79654.1} OX=35708 OS=Arundo donax (Giant reed) (Donax arundinaceus). GN= OC=PACMAD clade; Arundinoideae; Arundineae; Arundo.
Sequence
MPIITPAYPCMNSSYNVSISTRHVMIQEFTRAYEICQVHLISTSSSFH
Download sequence
Identical sequences A0A0A9UI04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]