SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9W0D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9W0D4
Domain Number 1 Region: 111-231
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-33
Family cAMP-binding domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 240-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-31
Family cAMP-binding domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.75e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9W0D4
Sequence length 373
Comment (tr|A0A0A9W0D4|A0A0A9W0D4_LYGHE) cAMP-dependent protein kinase type I regulatory subunit {ECO:0000313|EMBL:JAG01289.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_65198 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MASNLDEEQSLRECEAYVQEHSIQQVLKDCIVQLCVSRPDNPITFLREYFQKLEREQAAQ
DAKQLVTSPEDTEDLSPLPNSAQQPARRRGGISAEPVTEEDATSYVKKVVPKDYKTMAAL
SKAIAKNVLFSHLDENERSDIFDAMFPVNFLPGETIITQGDEGDNFYVIDLGEVEVYVNS
ELAVTIGEGSSFGELALIYGTPRAATVKAKTAVKLWGIDRDSYRRILMGSTIRKRKMYEG
FLSRVSILESLDKWERLTVADALETVSFSDNETIVKQGEPGDDFYIIVEGTALVLQCRGE
GDTSVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKR
NITQYNSFVSLSV
Download sequence
Identical sequences A0A0A9W0D4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]