SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9WGK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9WGK1
Domain Number 1 Region: 78-122
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000000000497
Family Poly(A) polymerase, PAP, middle domain 0.055
Further Details:      
 
Domain Number 2 Region: 12-73
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000316
Family Poly(A) polymerase, PAP, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A9WGK1
Sequence length 127
Comment (tr|A0A0A9WGK1|A0A0A9WGK1_LYGHE) PAP-associated domain-containing protein 5 {ECO:0000313|EMBL:JAG07567.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_11373 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MTLSNVPVCADEALPLLAKAIHEASLCEDIYPQVILKTKVPLIKFQHKHSHIEVDISVEA
VDGKDNSDEVIRLMNLFPEARVLTVIIKYFLQQRDMHEPYRGGLGSYATTLLVISFLQHH
PIYTIHP
Download sequence
Identical sequences A0A0A9WGK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]