SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9X1T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9X1T3
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily PAZ domain 1.57e-37
Family PAZ domain 0.0046
Further Details:      
 
Domain Number 2 Region: 106-203
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000243
Family Ribonuclease H 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9X1T3
Sequence length 208
Comment (tr|A0A0A9X1T3|A0A0A9X1T3_LYGHE) Protein piwi {ECO:0000313|EMBL:JAG12748.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_284 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
IVGSVVLTGYNNRTYRIDDVDYDVTPMSTFELKGLEKTTYVDYYRKKYNIRIQYPDQPLL
VSKSKPREIRAGMSSIVYLVPELCRLTGFTDEMRSNFPLMRALADHTRMPPNVRVDRLMV
FNARLQNTPSIQKDLENWQMRLAPNLISFGGRILDQEEIHFGQSVKVRAGTDADWTRNMR
SNPMFDMGSLKSWVVIFLKKSRNDVHTF
Download sequence
Identical sequences A0A0A9X1T3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]