SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9X8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9X8W1
Domain Number 1 Region: 275-406
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-39
Family Regulator of G-protein signaling, RGS 0.0000243
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.41e-27
Family DEP domain 0.0041
Further Details:      
 
Domain Number 3 Region: 206-264
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000034
Family Transducin (heterotrimeric G protein), gamma chain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A9X8W1
Sequence length 579
Comment (tr|A0A0A9X8W1|A0A0A9X8W1_LYGHE) Regulator of G-protein signaling 7 {ECO:0000313|EMBL:JAG13535.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_54217 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MEPRPYAFHKMEALVKQMQDPETGVPVRSQKIFLTSVPSAFIGYDLIEWLMEHLNMEESG
EAVHLANQLCQYGYLFPVTDCKTLNVKDDNSLYRFQTAYYWPWHHRNPDNVEYAIYLMKR
TLRNKQRHALEDYEVETFNSLKRNLQNKWELVTMQAEEQVKVGKERKKMDKLVADSQERA
YWRVHRPPPGCQPPLEPSPITTLRRSTSPSSPNTEVELLRRQVSKSRVKVSQAVENLVTY
STTYAEYDPFFTQPQPSNPWLTDDPAFWQFNQPIVEVPTERRVKRWALSFEDLLSDPTGV
EEFSNFLRKEYSHENIRFWLAVKELRYCAQSQVSSKVNTIYQEFLAHGAPCEVNIDSKTQ
ESTSNEMKNPSRFTFDSAAHHVYTVLLNKDCYPRFVRSEQYKNLLANALHPPTKKRLDDH
IVHMTRFFGFGGGGKKKSCAGSAVSTGGMNKRRGSDRSLTGLVHEAPHFTSPPQTHVPLS
TSQSNLHNITISRDLGVSPERINVTYRDIKQKSMEECNKQSSDDELLTLSEGALHSKPGP
SLKLSHASLEKVTNEEENPSEKESKPQLVESQEKESKPQ
Download sequence
Identical sequences A0A0A9X8W1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]