SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9X9V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9X9V4
Domain Number 1 Region: 26-148
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-39
Family Regulator of G-protein signaling, RGS 0.0000718
Further Details:      
 
Domain Number 2 Region: 289-373
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.82e-21
Family Ras-binding domain, RBD 0.0051
Further Details:      
 
Domain Number 3 Region: 233-301
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000372
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9X9V4
Sequence length 628
Comment (tr|A0A0A9X9V4|A0A0A9X9V4_LYGHE) Regulator of G-protein signaling loco {ECO:0000313|EMBL:JAG17497.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_46571 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MTGRILKSLCYWKSVFGEHEGEEKGVSAWATSFEKLLEDQFGLHIFAEFLKKEFSHENIY
FWVACEKYKNTTDPIERKHVAREIFERHLALGALEPVNVDSYARQVTEEQLEKATPTLFI
LAQKQIFNLMKFDSYSRFIKSDLYKECVVRVLAGKELPVLDSHSDLVLSTTPQHTKLKKS
RSDADERRRKSLLPWSRKTRAKSRDRVSFDHDDSSVSSSRSSLTAWDVPLSSGMCRVILP
DGSTAVVHTRANQSVRHLISRLLDRRALLYSDFQVIHSYLNKTISLDEDAIFLSGQEVKI
ERRVVFRLDLPNRKTIAVKSKECKTLSEVLGPILQKYSYRLEMVTLCLMSENEVLEPNLS
VTVADKKRIQVLTRSTPTECTKSLDEITNRVFEELLQGKAENKDVAATASDQGSVRSEDW
GSESSSGVLGRLLRRDSALIDKNRKNKKGAKTEENERKSTLSKLPPLIAKLKPSSKFESR
SESDVSFAVLYEGLKRAQRSRLEDQRGTEINFELPDFLKDKENTPQGGKKFRKVKTDNEE
SPSKFFTNDTRLNPPLESCSKTYSAGDLTRTSTEDLLVINKPPRLSPPPLPPKPKKLPVG
TSWPRPVEPKPRPRARTVYLDQPSSSFV
Download sequence
Identical sequences A0A0A9X9V4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]