SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9XMM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9XMM4
Domain Number 1 Region: 292-413
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-34
Family cAMP-binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 159-280
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-29
Family cAMP-binding domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 47-83
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000994
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9XMM4
Sequence length 530
Comment (tr|A0A0A9XMM4|A0A0A9XMM4_LYGHE) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:JAG21204.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_8097 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MSHIMSSNIHRNQYQKVTLKSQDISHDYDANTLKLMLADSRDGLVYRPSIWKNLIVDFTL
SFLITNPTDLISFGLEYFENLRTKKYVMNEERSLSDEEEEEEGESHFPRAWAKVESKNKE
RRLSPSGLAGPPPRIRRKSVFSDPTDTDDDDESWVPAVHPKTDEQRRNCRERMKEVMLFR
EVSPEDLSALVDAMIFKEVEPGEKIITQGEDGDYFYIIDSGLYEAYFASNEGVKGIAKYN
NHGTFGELALMYNVPRTCSVRALTRGGLWALERDTFKRIVVKGAKRKRTQYMNFLHKVPL
LKNLTEYEMLNLADSFVRRTFNVGEAIVRQGDEADGMYFIEEGQVGVSRIDESGKEIGLQ
ELEVGNYFGELALLEKQPRAATAYAMTDVKLAFLCAEAFERLLGSCRQVLERRASEYKKE
MHVGKSISKPELEHEKPASSSILKRDKQETSAAASLRRSVYREGSHQNVKVKEPEEESEG
AAESAKRRSTRRSSLSRRSTTTSRSSKFYDRKPSIFQMLPEVMQNSSVHE
Download sequence
Identical sequences A0A0A9XMM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]