SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9Y0I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9Y0I0
Domain Number 1 Region: 674-901
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-55
Family DBL homology domain (DH-domain) 0.000000668
Further Details:      
 
Domain Number 2 Region: 189-350
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-38
Family Regulator of G-protein signaling, RGS 0.000088
Further Details:      
 
Domain Number 3 Region: 906-1030
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-31
Family Pleckstrin-homology domain (PH domain) 0.000071
Further Details:      
 
Domain Number 4 Region: 408-473
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.64e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9Y0I0
Sequence length 1380
Comment (tr|A0A0A9Y0I0|A0A0A9Y0I0_LYGHE) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:JAG25679.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_50685 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
SPPPPARPPSTPSSPFGLPSTPPPLPPRQYLLLGGGDHLSPSISPGANHQVHTHQRTKSS
PDSMTANSSLAEASKRLIASESMSELSLAKRSRGGVAWEVDRPTSPSTPPGTPPPPYNMG
YSALDDTVYSHIPEEDSPPRAECSLTETDHATSPAKNFNFLAQGSPQQPIISMEDEDMSD
QEMSQMEDHGPFKRWNKLSKHQAHLAVFLNYVISNSDPSSLLFYLVTDLYKEGSAKEMKK
WAYEIHSSFLVPGAPLRLNNVDENVAREIDEVLLNESDKEEILRKIFWKARQKAKDELNE
QLADFQAKRTAGLGTLFGPKDAELEESIHDKNKEMKIIESVLVPKLEPYMEDIENGTVDD
RRFTTGAALGTVLSKVFGIRGQHFNSLLERCPTYVSKDKSRPSAKARLIGKTRKVSIRGH
QCIAHQYFIVTYCNHCQTIIWGIGPQGYRCSNCGLNIHRRCVSVLEENCPGPMIDKKGKG
NNRIRILIGQIRQERKPSSPSIPPNDRTKKVSEEAESAEHETGERSSEKSSRGSTRSEKR
PDPTREGEETPQEEGEAANNFQEISQHVPKNRPSNPINRSESYKERIHQKRQLRERRKTS
DPNLSKSNNDIEVDAQALSFKSNSGSSSNSSLSTRSLESPSQSLDAVGGGSGQPPGQQAT
AWDSDMEAEPDPPDWTTSVPEEVFSQLSPNERKRQEVINELFYSERSHVQALRVLDQIFY
KPMKEQQILPQDQISLLFSNLEEFLTFHSQFNTSMKAKRKENVVVGNISELLLNQFDGTY
GESFKKAAATFCAKQQIALETLKERRRKDPKLNSFLSEAESNSYCRRRQLKDIIPTGWQR
LTKYPLLFENLAKYTLKEEEEEHSRLKIAIEKSKELLNYVDMAVKEAEDEHRLAEIQRKL
DKSQFDKTEHHIAQEFKNLDLTKHKLIHEGSLCWRMTNRQKTTELHVLLLDDAIILLQKQ
DEKFLLKFNSLALSPIIKVSTVLVRHNAVDKKALFLVNTSHNGAQIYDLVANSISEKRKW
FKHISDAAEAYKQREGKHRGRTEGRTEGATSEFDSSEPRESRDHDDTLDTSADRSYPSAE
SPVPCVPSGSSTPQPGSPLTLADKLEGLEQPGTPEKSDKPARSPHASVGSEPPGSEVHVA
TSTAETTLVDPSEVVVSSRDVLTAEPVLTPLEKLRRKDELVRQILYEKQEIVADILHVPR
EEFENIADLAGEPSADKDPSELVLAAVNQAHELSLVVNEALRLSEEEAVAATSETTAAGG
SRSGRIPGVPVHRLTGIASALTSHLTQLLNIMTERDEERERLRRELQRSREQLHALHEKY
DHNGPSDPGSIPVNKSDEAKTETPPAEPTQSTAGEVFVDALTEGEEATQEEKPISAQVDK
Download sequence
Identical sequences A0A0A9Y0I0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]