SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9Y304 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9Y304
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000589
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9Y304
Sequence length 157
Comment (tr|A0A0A9Y304|A0A0A9Y304_LYGHE) Phosphorylated adapter RNA export protein {ECO:0000313|EMBL:JAG27437.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_25893 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MKREFGSCIRQIGNRQSSAVPTAQAVRDARLCIEECVYKGLGFMEEHNLNKDQLLEQLKK
GVAGKKDWEKPMEDAVKSCHETITKRETPQEGACQDSAHEFTHCVMRQLFLSCPASEWNN
NDECNLVKNRMQACPNIPPPPPPPPQGFRGQGPPPPQ
Download sequence
Identical sequences A0A0A9Y304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]