SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9YZI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9YZI6
Domain Number 1 Region: 128-241
Classification Level Classification E-value
Superfamily SH2 domain 9.29e-21
Family SH2 domain 0.00021
Further Details:      
 
Domain Number 2 Region: 248-297
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000144
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A9YZI6
Sequence length 299
Comment (tr|A0A0A9YZI6|A0A0A9YZI6_LYGHE) Suppressor of cytokine signaling 2 {ECO:0000313|EMBL:JAG38442.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_88397 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MAPHTMMDYANQEWGLVMLTSCPRCQHTFRSPCCGPCCPSYPAQHAACPTTVGPTRCTTS
AHASTISLSGGCFSARNLSPGSCCGGPRSPDPSPSLPLSFVLPSPPINPKPHVPLALHNA
SDLDLQRLSVTLRCLKSSGWYYEGLTWQESITLLAPTAPGTFLVRESSNPSYLFSLSVQA
EKGPTSVRIHYVNGYFRLDAEPSILPAVPLFDCVVKMIEYYIYTSQEPKSNRDLVFLDRS
GAKYSSILLRRPLLRQAAPLQHLARLKVNELQKNGDTVPNLHVLPSTLRHYLKEYPYAH
Download sequence
Identical sequences A0A0A9YZI6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]