SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9Z4T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9Z4T2
Domain Number 1 Region: 28-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000781
Family Ovomucoid domain III-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9Z4T2
Sequence length 129
Comment (tr|A0A0A9Z4T2|A0A0A9Z4T2_LYGHE) Enhancer of split M1 protein {ECO:0000313|EMBL:JAG39469.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_48949 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
LPSVIMQSYALVIVSVVVLRDVTAQVEECPQYCSPVNNNYGPACASFGRSFKTFPNLCEL
FKERCASRRNGGPVIEFVKDGSCTTSVQNPRRIQPAVCPESCPANSNDSGAVCALVGSNF
KTFPNYCEM
Download sequence
Identical sequences A0A0A9Z4T2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]