SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0D356 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0D356
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2.04e-30
Family Family 1 bi-partite nucleotidyltransferase subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B0D356
Sequence length 132
Comment (tr|A0A0B0D356|A0A0B0D356_9BACI) Nucleotidyltransferase {ECO:0000313|EMBL:KHE68589.1} KW=Complete proteome; Reference proteome OX=1543706 OS=Halobacillus sp. BBL2006. GN=LD39_14335 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Halobacillus.
Sequence
MERLRQRLEAAEKALVAFEKLATLKNPNDVERDAAIQRFEFSFEASWKAAKQYLYDIEGV
DAGSPKSVIRSCREVNLLEDEEAVLALEMVNDRNLTVHTYNEEVAIKIHKNLTRYNNLLH
QWVERMNGKVME
Download sequence
Identical sequences A0A0B0D356
WP_035548430.1.71687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]