SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0E3T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0E3T2
Domain Number 1 Region: 47-177
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.09e-22
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0E3T2
Sequence length 590
Comment (tr|A0A0B0E3T2|A0A0B0E3T2_NEUCS) Uncharacterized protein {ECO:0000313|EMBL:KHE85268.1} KW=Complete proteome OX=5141 OS=Neurospora crassa. GN=GE21DRAFT_3014 OC=Neurospora.
Sequence
MPPARLRTLSLSPSRRKSARFSSDSDHSDPDSTMAQSRPSSMAIPPPSLRDILSNTAPPP
YTFGAFLAFLSHNHCLETLEFTLGADQYRKAYNDIMLGRCRPTPDGLHQLRSMWEKLMNA
YIRPNSSHEVNLPAHVRDRLVQLSCAEQPPCPSELDQAVAYTYDLMEGSILGPFLESLAP
TPSPAPASTHPTSSHSTTHSHSHSHSHSHSHSLSHSRSYWKDLVHDPRRAHGGASPPPQH
DGQQSNRSSKTSGLLPLHTFGWQSETSSRSASSSTVADSPIDGFTDDSSSGYPSGNEPMT
PPTTPPSADWTFGTSPSGISRAMHTSGWKKMGAKLGLGKKSRSKRSQTTSVPSTGYGYEI
ALDGARSSPRLHPTTSAESINSDYSMEDVADVKLEPPILVQWEESTPGQHIPSPMAGNNN
AVQDAGREGRLHKDGMAAKGYTPYIRTTPEGVARRFTRPRVRRAISSNPAVTVDKSATNN
KPAVSSPLRTVSASNLRSKFLAVDHSQDQYLKPPTVVDPYGWEAAYSGEKLEADDEQTCL
ENFGFDEATLVKLTYRSAGGERRNLFHRMFAHAPRAEGGATATTTLALKA
Download sequence
Identical sequences A0A0B0E3T2 F5HCN3
NCU05435T0 XP_963258.3.24337 5141.NCU05435.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]