SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0HNG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B0HNG8
Domain Number - Region: 108-158
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0549
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0HNG8
Sequence length 162
Comment (tr|A0A0B0HNG8|A0A0B0HNG8_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KHF30580.1} KW=Complete proteome; Reference proteome OX=1548750 OS=Anoxybacillus sp. BCO1. GN=LR68_00531 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
Sequence
MGNTVVLNQTKQVEQLLSRIVEQIARYLNETTIEQMQEECAGDRRYYEGVLADLRRLAVY
GEEGVDACRIVLQEEPFRKAAAEQALYKIYHSCVAEFFTPKRDLWYEDSRSAYTGRHSIK
LRQPAPPSLQQLLHAIEADFQTMREELEFYETDYRTKMIQSQ
Download sequence
Identical sequences A0A0B0HNG8 A0A0D0HKT5
WP_021094515.1.15443 WP_021094515.1.5075 WP_021094515.1.72693 WP_021094515.1.74080 WP_021094515.1.83661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]