SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0I148 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0I148
Domain Number 1 Region: 138-281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.65e-54
Family AadK C-terminal domain-like 0.000000612
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.25e-45
Family AadK N-terminal domain-like 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0I148
Sequence length 290
Comment (tr|A0A0B0I148|A0A0B0I148_9BACL) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:KHF33456.1} KW=Complete proteome; Reference proteome OX=1472719 OS=Paenibacillus sp. P1XP2. GN=CM49_04250 OC=Paenibacillus.
Sequence
MRNEQQFMDLLVDFAVNDPRIRMVTLEGSRTNVNIARDAFQDFDISYFVTDMDSFKASDE
WLNVFGERLMMQKPEDMELFPPELGNWFSYIILFEDGLKLDLTLIPVAESDEYFAGSDGL
VDVLLDKDGFVKREVRPSDRQYWIHKPTAREFDDCCNEFWMVSTYVAKGLARKEILFAID
HLNEIARPNLLRMMSWQIGTEKGFSFSVGKNYKFIDRYLPPEDWEKLLSTYAGHGYASMR
QSLLTCYELFRKYSKMVSASLGYDYPDYDAAITGYTERIMQNLTLHDKDR
Download sequence
Identical sequences A0A0B0I148
WP_036713062.1.43715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]