SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0MCH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0MCH7
Domain Number 1 Region: 23-165
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000159
Family Poly(A) polymerase, PAP, N-terminal domain 0.064
Further Details:      
 
Domain Number 2 Region: 146-226,255-283
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000000000208
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0MCH7
Sequence length 305
Comment (tr|A0A0B0MCH7|A0A0B0MCH7_GOSAR) PAP-associated domain-containing 5 {ECO:0000313|EMBL:KHF99817.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_18405 OC=Gossypium.
Sequence
MGEHEGWAALQPPNGLLPNGLLPNEAASVIQMLDPERWMKAEERTADLIACIQPDAPSAG
RRNDVADYVQRLITKCFPCQVFTFGSVPLKTYLPDGDIDLMAFSKNQNLKDMWAHQVRDM
LENEEKNENAEFRVKEVQYIQAENHLFKRSIILIKAWCYYESRILGAHHGLVSTYALETL
VLYIFHVFNKSFSGPLEVAIKFDWENFCVSLWGPVPISSLPEITAELPRKDGGELLLSKY
FLHTCSSRYAVCQENQGQPFVSKHFNVIDPLRINNNLGRSVSKVGRKQGEEIVIGGKKCG
STWLE
Download sequence
Identical sequences A0A0B0MCH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]