SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0N171 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0N171
Domain Number 1 Region: 365-481
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000177
Family Regulator of G-protein signaling, RGS 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0N171
Sequence length 533
Comment (tr|A0A0B0N171|A0A0B0N171_GOSAR) Serine/threonine-protein kinase PLK4 {ECO:0000313|EMBL:KHG06765.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_33245 OC=Gossypium.
Sequence
MASCAVRGGCPSDYVAVSIAIFSMILLIVRSTFPFFIHKVPIAKGSAFWIPVIQVIASFN
FLLAIVMAVNFLKYKKSHWWLSCYVWAVWLEGPLGFGLLMSCRIAQAFQLFYVFVKFFKV
LPPSDAPPFICVLSLDIRSVAYTDFYVVMWFEFLEVYLRVTTLRELWVPKEDNFGICSYD
MAHAQQAERRLPPIRSHMFLPLILLPWVAGAAVIHEKKPLNYRCHFGTYWTIPVVCLHSL
YVAVLMGFTRAIRHIEFRFDELRDLWQGILGSASLIGVWVFAYILNEIHDDISWLQVASR
FMLLVTASILVLVFFSISIAQPLLSQISLRKREPLELKTMGQVLGIPESGLLLQREQAVD
IDPNEPLDKLLLNKRFRQSFMAFADSCLAGESVHFFDEVHELGKIPIDDPSCIYPMSCPT
CHSGAAMEVNISHRIRQEILATTDLTHPDLFTNALHELTQLMKMNLAKDYWSSIYFIKFK
EEARMRSCEHEMEEMRGYDFSPRLSSVNATDDPFHQDHFSRGFTQHSHASYLR
Download sequence
Identical sequences A0A0B0N171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]