SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0N6B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B0N6B3
Domain Number - Region: 191-231
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0112
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0N6B3
Sequence length 269
Comment (tr|A0A0B0N6B3|A0A0B0N6B3_GOSAR) Methylsterol monooxygenase 2-2-like protein {ECO:0000313|EMBL:KHG10028.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_07348 OC=Gossypium.
Sequence
MAAIIESGWLYLITHFSDFQLASLGSFFLHESVFFLSGLPFIYLERAGLLSKYKIQTKNN
SLAAQEKCITRLLLYHIGVNLPLMIASYPFFRFMGMKSSLPFPSWKVVLSQIIFYFILED
FVFYWGHRILHTKWLYKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIIGPAITGPHL
ITLWLWMTLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVY
MDWIFGTDKGYRKLKALKRDGVEEESKQT
Download sequence
Identical sequences A0A0B0N6B3 A0A0D2MN53 A0A1U8NRP6
XP_012471282.1.20347 XP_016740629.1.88148 XP_017639067.1.75545 Gorai.003G128800.1|PACid:26799614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]