SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0NRX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0NRX9
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Prefoldin 5.49e-24
Family Prefoldin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0NRX9
Sequence length 105
Comment (tr|A0A0B0NRX9|A0A0B0NRX9_GOSAR) Prefoldin subunit 6 {ECO:0000313|EMBL:KHG15407.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_08722 OC=Gossypium.
Sequence
MNIAKSHQVRKKYTIQLGENELVLKELDLLNEDANVYKLIGPVLVKQDLAEANANVRKRI
EYISAELKRLDSSLQDLEEKQHSKREAILKVQQRIQSLQAGKAKA
Download sequence
Identical sequences A0A0B0NRX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]