SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0P3E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0P3E7
Domain Number 1 Region: 53-249
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 6.67e-62
Family Chlorophyll a-b binding protein 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0P3E7
Sequence length 252
Comment (tr|A0A0B0P3E7|A0A0B0P3E7_GOSAR) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_06915 OC=Gossypium.
Sequence
MATVTTQASAAVFRPCASKTRFLTGSSGKLNRDVSFKPVAATSTSSFKVEAKKGEWLPGL
PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI
INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPH
ECGYPGSIFNPLNFAPTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDP
WHNTIINTIRGY
Download sequence
Identical sequences A0A0B0P3E7 A0A1U8LES3
XP_016713101.1.88148 XP_017610620.1.75545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]