SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0P8A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0P8A5
Domain Number 1 Region: 118-204
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.1e-22
Family tRNA-intron endonuclease catalytic domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0P8A5
Sequence length 245
Comment (tr|A0A0B0P8A5|A0A0B0P8A5_GOSAR) tRNA-splicing endonuclease subunit Sen2-1-like protein {ECO:0000313|EMBL:KHG20309.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_25476 OC=Gossypium.
Sequence
MMPRWKGKGLQAKANADPMSKIVSQLQSSLIQFETRGLLSSCSVLVEVDAELADLLNRSC
FGRPRITAQEDKQWFQLDMEEAFYLCFSLKCLKVIGEDGSIKSNEELWDYFKSKKLVFPV
SYKVYSHLRHKNWVVRSGLQYGVDFVAYRHHPALVHSEYAVLALSEGDNDLNGRLRVWSD
VHCTVRLCGSVAKTLLTVIVNSNNQGANSPSCLEHYTVEERTITRWNPERSREDQTGPKN
GTKKV
Download sequence
Identical sequences A0A0B0P8A5 A0A1U8P2S6
XP_016745516.1.88148 XP_016745517.1.88148 XP_016745518.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]