SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0PB91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0PB91
Domain Number 1 Region: 73-116
Classification Level Classification E-value
Superfamily HIT-like 4.49e-16
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.00065
Further Details:      
 
Domain Number 2 Region: 151-210
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000419
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0PB91
Sequence length 230
Comment (tr|A0A0B0PB91|A0A0B0PB91_GOSAR) 14 kDa zinc-binding {ECO:0000313|EMBL:KHG21609.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_28354 OC=Gossypium.
Sequence
MAAFTSFSLLRNYAMTGRIVAIVRASPRLSSFPTSIDFLTPNHSRRYLCCASPTHDEEAT
AKAAAINADSGAPTIFDKIIAKEIPSTIVYEDDKVLAFKDISPQAPVHVLVIPKFRDGLT
QLGKAEQRHGEILGQLLLLDAPLLKLSYPSSLASKGEKDWTRRIGNDRHLVCIEDPFVVS
HDLGRVVEKFSIKVLKEEFERAVDVMQYDPNPWITLFEPYDPGQCALHPQ
Download sequence
Identical sequences A0A0B0PB91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]