SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1PI61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1PI61
Domain Number 1 Region: 302-427
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-39
Family Regulator of G-protein signaling, RGS 0.0000308
Further Details:      
 
Domain Number 2 Region: 14-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-25
Family DEP domain 0.02
Further Details:      
 
Domain Number 3 Region: 227-288
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000209
Family Transducin (heterotrimeric G protein), gamma chain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B1PI61
Sequence length 461
Comment (tr|A0A0B1PI61|A0A0B1PI61_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KHJ41394.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=D918_08504 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MNTWGDRPQHPYHIVYRKMEKLIQLMLHDTEGVPVRTVKSFISKIPSVFTGIDLVQWINQ
HVTTDDLTEALHLSHMLASHGYLFPIDDHLLMVKCDNTFYRFQTPYFWASNCWEPDNTDY
AVYLCKRTMHNKAHLELEDFEAENLAKLQKMFCRKWEFIFMQAEAQYKVDKKRDRLERQI
LDSQERAFWDLHRPVPGAVNTTEIDFRKLSRCHRIRPTENRNVRQSNNRSKSTVERYENE
VQLLQSRLARNALKTSKVAEFLIAYSEHRTEFDPLFKTPEPSNPWISDQTDFWDLERTGE
LNGRRVRRWALSFDELLSDTAGRECFMKFLEKEYSGENLRFWEAVQSLRFSSCRMVPVKV
TSIYNDYLGPSAASPVNVDSKVMDITNKNLENSGRWSFDEAAEHIYCLMKNDSYQRFIRS
DHYKELICGEKKKSVGKMAGLRSVISFPGKRDVSLLPMKLS
Download sequence
Identical sequences A0A0B1PI61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]