SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1PMT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1PMT7
Domain Number 1 Region: 147-191
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000977
Family MYND zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B1PMT7
Sequence length 283
Comment (tr|A0A0B1PMT7|A0A0B1PMT7_9BILA) MYND finger {ECO:0000313|EMBL:KHJ43049.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=D918_06909 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MKIPGKRVRRKTTEQQMAKAVELGFIMSSEPCNLASPFFPCKFGGKPAWLNLADIPSYEN
LKCGQCSAPMTFLLQIYAPVDSVSTAFHRMLYVFLCKNKTCWEPKQSVNNVTVFRSQLPR
INDFYPEKQTEPCTPEGSAAVTKVSSLCKRLCEVCGIFAPNFCGKCQSVHYCSKEHQRLH
WNVGHKQECSGSKKESCKNVLLFPEYEIVTEVEQFTEESKPERSTEKRMEAYRQYMASID
LNAAKDKSKNYGAEELESMSKEADKDFKRFRARIEQNPEQVGA
Download sequence
Identical sequences A0A0B1PMT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]