SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1Q3W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1Q3W0
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.19e-36
Family N-utilization substance G protein NusG, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 121-176
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.44e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1Q3W0
Sequence length 176
Comment (tr|A0A0B1Q3W0|A0A0B1Q3W0_9RHIZ) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=370622 OS=Aureimonas altamirensis. GN=LA66_11130 OC=Aurantimonadaceae; Aureimonas.
Sequence
MAARWYIVHAYSNFEKKVAESIEEQARQKGLSDKFEKILVPTEKVVEVRRGRKVDAERKF
FPGYVLVKAELTDQVFSLIKNTPKVTGFLGPDNRPVPISEAEATHILSQVQEGVERPKAS
ITFDIGEQVRVSDGPFASFNGIVQEVDQERARLKVEVSIFGRATPVDLEFGQVEKV
Download sequence
Identical sequences A0A0B1Q3W0 A0A1M6CAA7
WP_039192509.1.10225 WP_039192509.1.48347 WP_039192509.1.73204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]