SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1S636 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1S636
Domain Number 1 Region: 21-66
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000000248
Family Cysteine-rich DNA binding domain, (DM domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B1S636
Sequence length 120
Comment (tr|A0A0B1S636|A0A0B1S636_OESDE) DM DNA binding domain protein {ECO:0000313|EMBL:KHJ78630.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_10792 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MDPSKKQRQLGQLPLITENDNKKIYFCQRCLNHGSRLPRKNHKCECPYADCKCEFCFLVE
KRRQLNSQLHDLEGVDTDSSKGATGDEETVTSNGDGEADRMIRVKGGESLVSTGCLCRTA
Download sequence
Identical sequences A0A0B1S636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]