SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1S946 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1S946
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 3.14e-43
Family Nicotinic receptor ligand binding domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 179-237
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.28e-18
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B1S946
Sequence length 249
Comment (tr|A0A0B1S946|A0A0B1S946_OESDE) Neurotransmitter-gated ion-channel ligand binding domain protein {ECO:0000313|EMBL:KHJ80431.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_19894 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MFIEGMSSFSAQTMDYHLDMYFQQEWYDHRLAHKHASPILVKDKRVFGEMWHPDVYFANA
KSASFQEITDDNFLVWVYPDGRVWYDARISIVVSCNMDLWKYPLDSQHCPLRVLSYAYPE
TVLRLVWSDKDGNPPIDRNREITMPDMQLKDIRTGYCNGTYATGVWSCMTAVFYVEREMM
HHVMQTYLPTALIVVISWFNFWLDVDSAPARVSLSITTLLTISTQANAVKLALPEGNYTN
FTKVNISRT
Download sequence
Identical sequences A0A0B1S946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]