SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1SPT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1SPT1
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.19e-24
Family RNA editing terminal uridyl transferase 2, RET2, catalytic domain 0.067
Further Details:      
 
Domain Number 2 Region: 159-288
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000145
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1SPT1
Sequence length 291
Comment (tr|A0A0B1SPT1|A0A0B1SPT1_OESDE) Uncharacterized protein {ECO:0000313|EMBL:KHJ86964.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_13272 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MVIQHIKDPLCQGFSAQIHRLASTIGTTETELSRRTVICQRLEELLRRYILNSKVVQFGS
AITGLGTNDSDMDLCLSFAPNETSLVHQTEVVFRILKELRREKCGFFKSLYAVSDARCPV
IRFRAYDGHLVELSVNNTIGYQKSAYLGALVQADQSGLLRELILALRFWAASNGVFKSER
KKTWNLNSYTMTLMFLTFLRMEEIVPDFTHSDSPEMVNGLRVDFAVPSFTLAGIDFRRLF
KKFFVCCVEGHLDKLVFSLRKGALVPLAELDVQMNSKPESILFVQNKFCFC
Download sequence
Identical sequences A0A0B1SPT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]