SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1SQK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1SQK5
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000115
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1SQK5
Sequence length 395
Comment (tr|A0A0B1SQK5|A0A0B1SQK5_OESDE) Transient receptor ion channel II {ECO:0000313|EMBL:KHJ87593.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_12631 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MKNIEMIELLLDNNIETGDAILYAIGEENVEAVEIIIEHLEKIDKFNPETQGVEINEHSA
FTPDITPIILAAHKDNYEVIKLFLDKKGTVPHPHDVHCCCHDCEVAREEDSLRLSRSRIN
AYRALASPSLICLSAKDPILYAFELSWELRRLSYIENEFRNEYQELSQKCQKFSVNMLDQ
VRGSKELEIVLNHTTTAWEEVTTRGTPTTEQLARLKLAIKLRQKRFVAHPNCQQLLAGIW
YEGLPGFRNRNIVYKCLLIAAVSLSFPILSISYLIAPKSSIAQFTRKPFVKFLSHSASYV
VFLLLLILASQRIDRVDNVFRDENAPDRKEGRGPPPTPVEIAIMVWVLGLIWVEIKQLWD
CGLHDYCYNLWNILDFITNSLYLTTAALRAVAYYQ
Download sequence
Identical sequences A0A0B1SQK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]