SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1SU79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1SU79
Domain Number 1 Region: 82-167
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.00000000148
Family tRNA-intron endonuclease catalytic domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1SU79
Sequence length 184
Comment (tr|A0A0B1SU79|A0A0B1SU79_OESDE) Putative tRNA intron endonuclease {ECO:0000313|EMBL:KHJ87451.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_12776 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MYVRGPAEQRAALITAATIERRDDTESKSVISLQNYITVDYVNDSYIIFDKDTDTSKGQY
HRLGDFDVPLPSTRDHRAREVILYDLCRKRYYLTSGEQFGCAYLVYEGVVSLPQRLRTSR
KSSCKGLLEYVEGNDDISMVDMISLLRIATQAEKDLLLSIIASDSHHPHYLKFEWFKQYS
KEFE
Download sequence
Identical sequences A0A0B1SU79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]