SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1TCZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1TCZ4
Domain Number 1 Region: 3-56
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.01e-19
Family Elongation factor TFIIS domain 2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B1TCZ4
Sequence length 105
Comment (tr|A0A0B1TCZ4|A0A0B1TCZ4_OESDE) Transcription factor S-II, central domain protein {ECO:0000313|EMBL:KHJ93220.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_06877 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
LQVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGAVKPEKFAVMTSEEMASDEVRQM
RDKFNKAALLEHQMSMQQGTPSGMFTCGKVWKEELHLHSTTNTFI
Download sequence
Identical sequences A0A0B1TCZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]