SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1TET8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1TET8
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-35
Family Regulator of G-protein signaling, RGS 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1TET8
Sequence length 159
Comment (tr|A0A0B1TET8|A0A0B1TET8_OESDE) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KHJ95779.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_04271 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
LALQPFARFSPNEWQFAFDHVISDADGRAQFTKFLQSEYSEENILFWWAVEELKTVCRSE
SRPEFERTVLEMFETFIASESPLAINIDHDTRTDIIERVENQDPSSFPDNIYERAQAHVY
RLMEKDCFSRFVHTPAYKEVAKKIGLPQTFRFNEKITPA
Download sequence
Identical sequences A0A0B1TET8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]