SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1Y2Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1Y2Z5
Domain Number 1 Region: 21-208
Classification Level Classification E-value
Superfamily Sortase 7.85e-37
Family Sortase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1Y2Z5
Sequence length 220
Comment (tr|A0A0B1Y2Z5|A0A0B1Y2Z5_9BACI) Sortase {ECO:0000313|EMBL:KHK51236.1} KW=Complete proteome OX=1571920 OS=Lysinibacillus sp. A1. GN=PI85_14940 OC=Lysinibacillus.
Sequence
MKRKKLKLALLLCALIIGLLLIFITPIQNALIARMSDQFNAVEYSTDDIKKNNQLDANFE
FEAVQSLSIAEVLQAQINASKMPVIGSIAVPSVHMQLPILKGVGNAVLAIGAGTMKPNQQ
LGQGNYALAGHYFEEKDILFSPLYQAQIGDIIYVTDMSNVYEYKLATKKIIAATDVYIVD
DIPNQTTLTLITCAEKGSKRLALQADFVQSYSLENAKGTF
Download sequence
Identical sequences A0A0B1Y2Z5
WP_036122941.1.48708 WP_036122941.1.75025 WP_036122941.1.8573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]