SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1Y9H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1Y9H3
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000719
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1Y9H3
Sequence length 254
Comment (tr|A0A0B1Y9H3|A0A0B1Y9H3_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KHK55155.1} KW=Complete proteome OX=1571920 OS=Lysinibacillus sp. A1. GN=PI85_04635 OC=Lysinibacillus.
Sequence
MNEVFKDIDEVIENMRSFISEIQQQDPSFYGIYPMIFHQPLEEDVSQLMGSHWQLPDEYI
YFLKHYVVEGITWNTGDYINLQIYGATDLVRGQDGYNYNPVTQEIISDWPQHYVVIATDE
GDPYCIDISRGDTAIFTAYHGAGSWDFEMAYDHLVAFLQSVLVPSNLEEEQLEDHSNNYY
EIYITGNGKDKLKTLLLLKKRLSCDYSIAKKSLEQLPLLIYRGIEAGALQLEKELQHIGA
DYQKKKISLAEFLT
Download sequence
Identical sequences A0A0B1Y9H3
WP_036127221.1.48708 WP_036127221.1.8573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]