SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1YE07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1YE07
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000196
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1YE07
Sequence length 423
Comment (tr|A0A0B1YE07|A0A0B1YE07_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KHK55717.1} KW=Complete proteome OX=1571920 OS=Lysinibacillus sp. A1. GN=PI85_02220 OC=Lysinibacillus.
Sequence
MWVDRWTQLLKQLEQQGAWIHPLEIKPMATVHELSMVEMRLGVPIPSEFRDVLLHCSRQV
GVYWSLPDEALLPIELEDTPLGDFGWSLEELEFPDFGGDSDNAKEQLYLQFHTAGNGDAL
LIKIEDGSVWYWSHEEDEYDLLALNFKDYVEKATTLGCIGADCGQCLQFCSEGGLDLSLT
TSQIWLKWFEQYLTSTWENVMYQLDTLLLYVSMHGMEDTRVREAFTRLNTGKVFAALQNQ
IEQSRRLADKEVWCKVLVEVCATEASHWVMTLWEDQNDLPNSIRDYLTAYCLPEEVGLSL
VLQDIEKRRIESYIALQRLRDFHNPRTIAWMKRYVSFPIEGWDTLLVESQPSAETLFEWL
NGKEVERQIAIRAVCQMLQQGIKPTTSVDMEKWLSLLTFWKDNEVLRKHKQFFSQALEGI
ELW
Download sequence
Identical sequences A0A0B1YE07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]