SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2E0A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2E0A8
Domain Number 1 Region: 7-125
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000288
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2E0A8
Sequence length 139
Comment (tr|A0A0B2E0A8|A0A0B2E0A8_HELPX) Cell division protein {ECO:0000313|EMBL:KHL80398.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=HPY1089_01335 OC=Helicobacteraceae; Helicobacter.
Sequence
MDNIPTNTELNWEFVEPLNENAFHLLEERLKIGFSDAFKDFIKRSNYGFSQWRYFMVCNE
SYTFKHVLNFNLESLFIDFMQSLKEWLEPEEIVFANDGYGGYYLWNTTTDVVLFLDTDNG
SKKVLLNLKMFLKKLESRG
Download sequence
Identical sequences A0A0B2E0A8
WP_039082002.1.100016 WP_039082002.1.81129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]