SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2E7E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2E7E9
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000929
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2E7E9
Sequence length 139
Comment (tr|A0A0B2E7E9|A0A0B2E7E9_HELPX) Cell division protein {ECO:0000313|EMBL:KHL82589.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=HPY1786_03040 OC=Helicobacteraceae; Helicobacter.
Sequence
METIPANSELNWEFVEPLNDNALSDLEERLKIGFSDEFKDFIKRSNYGFSQWRYFMVGNE
SYMFKHVLNFNLEGLFIDFMQSLKEWLEPEEIVFANDGYGGYYLWNTTTDVVLFLDTDDG
SKKALLNLKMFLKKLESRG
Download sequence
Identical sequences A0A0B2E7E9
WP_042630184.1.65781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]