SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2ECZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2ECZ1
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000235
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2ECZ1
Sequence length 141
Comment (tr|A0A0B2ECZ1|A0A0B2ECZ1_HELPX) Cell division protein {ECO:0000313|EMBL:KHL82952.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=HPY173_06200 OC=Helicobacteraceae; Helicobacter.
Sequence
MDRISTETELNWEFVEPLNDNALSRLEERLKIGLSDEFKDFIKRSNYGFSQWRYFMVGNE
SYMFKHVLNFNLEGKGLFVDFMQSLKEWLDPEEIVFANDGYGGYYLWNTTTDVVLFLDTD
NGSKKVLLNLNMFLKKLESRG
Download sequence
Identical sequences A0A0B2ECZ1
WP_042632190.1.6738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]