SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2ET46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2ET46
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000131
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2ET46
Sequence length 141
Comment (tr|A0A0B2ET46|A0A0B2ET46_HELPX) Cell division protein {ECO:0000313|EMBL:KHL88041.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=HPY655_02890 OC=Helicobacteraceae; Helicobacter.
Sequence
MDRISTETELNWEFVEPLNGNALSDLEERLKIGLSGEFKDFIKRSNYGFSQWRYFMVGNE
SYTFKHVLNFNLEGKGLLIDFMQSLKEWLEPEEIVFANDGYGGYYLWNTTTDVVLFLDTD
DGSKKALLNFNMFLKKLESRG
Download sequence
Identical sequences A0A0B2ET46
WP_039087323.1.34871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]