SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2PAD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2PAD4
Domain Number 1 Region: 241-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000275
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2PAD4
Sequence length 295
Comment (tr|A0A0B2PAD4|A0A0B2PAD4_GLYSO) B3 domain-containing protein {ECO:0000313|EMBL:KHN06171.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_031613 OC=Phaseoleae; Glycine; Soja.
Sequence
MTTGAERYPDFFKVFLPERHSERMLIPNAFVRLPQLQGRIPEDVILRNAKNCLGHADFLV
FKHDRSNEFKVVILESSTQCQKPVVKMEEENEQEQAAAQHVEDCDIEEEEDSSSKDENYD
GSDSDDDEESEEEFSAGFKRQSHHRRACKRESASNSNPNAEDLLPEYVFDPEMCIQPENH
FFKAKLYKTRPNELVRILIWFLLFLCILSLLQQDISINLLGDCHHNLAQQTFIKTKYQQV
SGRVCRWKDYRIYIKGWDSFCRRNEIERDDTCFCEVISGEEQGVRTLRVHVARRR
Download sequence
Identical sequences A0A0B2PAD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]