SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2PBH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2PBH8
Domain Number 1 Region: 167-270
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.67e-19
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2PBH8
Sequence length 289
Comment (tr|A0A0B2PBH8|A0A0B2PBH8_GLYSO) Auxin-induced protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_024250 OC=Phaseoleae; Glycine; Soja.
Sequence
MNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNK
RGFADTMDGFSQGKFAGNTGMNAMLSPRPSGAQPSAMKEIPSKLQERPCSTKNGTGHNHT
GASISGSAPASKAQVVGWPPIRSFRKNSMATTTNKNNDEVDGKPGVGALFVKVSMDGAPY
LRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHGSEYVLT
YEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS
Download sequence
Identical sequences A0A0B2PBH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]