SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2PW68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2PW68
Domain Number 1 Region: 7-110
Classification Level Classification E-value
Superfamily SRP19 1.29e-33
Family SRP19 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2PW68
Sequence length 137
Comment (tr|A0A0B2PW68|A0A0B2PW68_GLYSO) Signal recognition particle 19 kDa protein {ECO:0000313|EMBL:KHN13375.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_026805 OC=Phaseoleae; Glycine; Soja.
Sequence
MDTSELPNLKKWIVMYPVYINSKKTMAEGRRIGLAKACENPTCAEIGDCCSYLKLPFAIE
IDKAYPRDFMQRGRVRVLLKKEDGTLFNSAISSRKQLMVKVAEMVPRHHGRTKKQDPAST
STAGPSTKSGKGGKKRR
Download sequence
Identical sequences A0A0B2PW68 C6TCJ7
Glyma16g26150.1|PACid:16302934 NP_001240053.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]