SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2Q2A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2Q2A6
Domain Number 1 Region: 68-230
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.4e-34
Family CRAL/TRIO domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000419
Family CRAL/TRIO N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2Q2A6
Sequence length 247
Comment (tr|A0A0B2Q2A6|A0A0B2Q2A6_GLYSO) CRAL-TRIO domain-containing protein {ECO:0000313|EMBL:KHN15460.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_036328 OC=Phaseoleae; Glycine; Soja.
Sequence
MDQGRDSALTQMRKSVEKLGSSAEGYGDPTLMRFLIARSMEVDKAAKMFLQWKKWRSAMV
PNGFISESEIPDELEARKIFLQGLSQDKFPVMIVQTNRHFASKDQIQFKKFVVYLLDKTI
ASAFKGREIGTEKLIGIIDLQNISYKNIDARGLITGFQFLQAYYPERLAKCYMLHMPWFF
VSVWKLVSRFLEKATLEKIVIVSNEDETREFVREVGEEVLPEMYGGRAKLEAIQDVELPP
LENGTTN
Download sequence
Identical sequences A0A0B2Q2A6 I1JDI4
XP_003518618.1.40590 Glyma02g09460.1|PACid:16247516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]